PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA018896-PA
Common NameOsI_18286
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 1709aa    MW: 183537 Da    PI: 7.0263
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA018896-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.21.6e-07856898347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +W +eE e++ +  + +G++ +++I++ ++ ++t  +c+++++k+
  BGIOSGA018896-PA 856 PWIQEEKEIFMEKLATFGKD-FSKISSFLQ-HKTTADCIEFYYKH 898
                       899***************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.54E-13839901IPR009057Homeodomain-like
PROSITE profilePS5129314.547852903IPR017884SANT domain
SMARTSM007174.8E-7853901IPR001005SANT/Myb domain
PfamPF002491.0E-5856898IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-5856900IPR009057Homeodomain-like
PROSITE profilePS5129313.72810611112IPR017884SANT domain
SMARTSM007176.6E-410621110IPR001005SANT/Myb domain
SuperFamilySSF466891.56E-810661112IPR009057Homeodomain-like
CDDcd001670.0013210661104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1709 aa     Download sequence    Send to blast
MASTAAAASR RVVGGVQDVG LELVARRTRR RSPRFARPSA RAILAVDRGA RDQGASASAH  60
AAADASPTWG ALGAAACTSD CLPDSTPRIS SAACSTGGGE GKAWTSTSLS DLRRPTSAAA  120
AAADSAGDGS PRIGGGRRRC RVGFFAAHGY YRQGGGSYDR SYPDESLGYT PSRSDRYWLD  180
DDGGGGGYKG FSRYGGGGGG GSRRDGRDMR GSYRRSPFRG YGSDFSRNHQ EHPPPPLRRS  240
PLRSVAVPMS YDPPGDRADR GDRDHHHRVT PWRPLRRRES RSDAADAAGA GPVPVGQAAA  300
AAASEKDVSA RSSAVAAPQV SEEEAPRKKP RLGWGQGLAK YEKQKVQGPA ESAEAVAEGS  360
PTATEQKGIT HTPAPAPCVS PVAAPSPAPC ASPVAAPSPA PCASPVAAPS PAPPCKSPVP  420
EDKSCELTAN TVTESNKNIP GPDVQACNNE VPTKLDQLEG DPIDSLAKVL SELVQHEDSC  480
SGDSKRLSNV SKLLLLKESI SKELEKTELE IDSLEGELKS VNVEARNRTL KDPPTAVTYA  540
QNPSPSPVKE QGELTPSPKI SMEQDADVKG SELMEVETAQ AHNAKAVSSE ESVACPGVAP  600
GQVPAAADVI PSDPCGKTGS GIDVDIEQRE ENPCQENFNA MKADGSSDLA TRPCSYREVK  660
YNLMDQIIAA NRSEAKKNSQ LLFKPVPADQ SNLDLLASSY LSSQMKNDVI IKKKHAILKN  720
RQRFKEQILT FKFRVLRHLW KEDVRLLSVR KQRSKSHKRT DQSNRSSQSG SQRQRSSNRS  780
RLAVPAGNLS TFPITEMSGV ARKLFSEFQL KRCRNYLKMP ALIVDEKEKA GAKFVSKNSL  840
VEDPVSVEKE RALINPWIQE EKEIFMEKLA TFGKDFSKIS SFLQHKTTAD CIEFYYKHHK  900
SDSFREVKKL LDLRQQQQPA SNYLGAVSGK KWNPEANAAS LDMLGVATEV AAQGLEYVNE  960
VKKNSAKSIL RTVCGVDNST KGSEKDCVGD VSLHERESVA ADVLAGICGT LSPEGMGSCI  1020
TSSADPGQKI GIISRMEHLL TPEADKNFDD DGTLSDQECE VDIVDWNDDE KSSFIEAMNR  1080
YGKDFARISS YVKSKSFEQC KVFFSKARKS LGLDLIHQGA ADAGFPTGDA NGGRSGTDGA  1140
CIAEMDSAIC SAQSCPKVEI DACPVSDGEI QGHNPLSDIA SRQPEADKSN MPDVVDINVE  1200
EGESKAEKDC SILVDHKQLR EDINQTSCAR IDINCPESTD KLQDIEDVTP VNMHGDDLMA  1260
TSVEQVAAAH VESRSSLHSE GIGIDVSRIE GCSHESTIGK GGKSTPSVCL PAENGVSKEN  1320
IIHFSNMDGA SSISPAFTSN YQQSKLADPI QSKPKPLTPK DLMPVQFSSS LPDPTSICFE  1380
GIAAITTPNF EDHGNRASIA SGAKDVNMFP TFKDQSSNRH DALFSNVDGY MQQRRNNHFG  1440
TEVCGLSEST GISQSDQFTV SKFQNGRPSS LGLSNGNLGV LSTGRREEAR EGLFRPCSVK  1500
TSAGNEEQQK RPGDVKLFGQ ILSHQSSLQS SGSSVHGSKS KPPSPKVDKP ASSRLLSNPR  1560
ERLVYSSRPP IIANLGLEER AMRSFDHMDG RTIQPEPMVM VAKCQRPSAG VPVYSTKNGA  1620
LSVFAEFQQP SMPPHTSDHK LLENFADLHK RNGIELLSGF QQPGRLGGAG VLVSGVSDPV  1680
AALKAQYGSG SKMLSSSNDV DTWKDIGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C3e-15814905494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D3e-15814905494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.104470.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977236600.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706530.0AK070653.1 Oryza sativa Japonica Group cDNA clone:J023055D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLA2XZX70.0A2XZX7_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA018896-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.14e-74MYB family protein